SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320202942|ref|NP_001188512.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320202942|ref|NP_001188512.1|
Domain Number 1 Region: 39-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.93e-45
Family Ankyrin repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 263-305
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000157
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320202942|ref|NP_001188512.1|
Sequence length 306
Comment ankyrin repeat and SOCS box protein 11 isoform c [Homo sapiens]
Sequence
MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLIAQACLGGHVACAKALLENGAHVNGVTVHGATPLFN
ACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLG
TPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRR
NAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLE
RFLLYQ
Download sequence
Identical sequences ENSP00000369837 gi|320202942|ref|NP_001188512.1| ENSP00000369837 NP_001188512.1.87134 NP_001188512.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]