SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320202962|ref|NP_001189332.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320202962|ref|NP_001189332.1|
Domain Number 1 Region: 48-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-25
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 336-384
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000732
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320202962|ref|NP_001189332.1|
Sequence length 392
Comment ankyrin repeat and SOCS box protein 6 isoform 3 [Homo sapiens]
Sequence
MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKA
HSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVE
LLVHHGADVNRRDRIHESSPLDLASEEPERLPCLQRLLDLGADVNAADKHGADVKATTKD
GDTVFTCIIFLLGETVGGDKEEAQMINRFCFQVTRLLLAHGADPSECPAHESLTHICLKS
FKLHFPLLRFLLESGAAYNCSLHGASCWSGFHIIFERLCSHPGCTEDESHADLLRKAETV
LDLMVTNSQKLQLPENFDIHPVGSLAEKIQALHFSLRQLESYPPPLKHLCRVAIRLYLQP
WPVDVKVKALPLPDRLKWYLLSEHSGSVEDDI
Download sequence
Identical sequences A0A2I3SM63 F6TX30
NP_001189332.1.87134 NP_001189332.1.92137 gi|320202962|ref|NP_001189332.1| ENSP00000416172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]