SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320461696|ref|NP_001189354.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320461696|ref|NP_001189354.1|
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-26
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320461696|ref|NP_001189354.1|
Sequence length 120
Comment zinc finger protein 177 isoform c [Homo sapiens]
Sequence
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRH
SLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNPHGREFL
Download sequence
Identical sequences ENSP00000413568 ENSP00000473272 gi|320461696|ref|NP_001189354.1| ENSP00000413568 ENSP00000473272 NP_001189354.1.87134 NP_001189354.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]