SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|321117022|ref|NP_001189393.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|321117022|ref|NP_001189393.1|
Domain Number 1 Region: 216-338
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.93e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 111-209
Classification Level Classification E-value
Superfamily Bromodomain 2.75e-16
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 3 Region: 503-546
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000101
Family MYND zinc finger 0.013
Further Details:      
 
Weak hits

Sequence:  gi|321117022|ref|NP_001189393.1|
Domain Number - Region: 409-474
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0302
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|321117022|ref|NP_001189393.1|
Sequence length 548
Comment zinc finger MYND domain-containing protein 11 isoform c [Homo sapiens]
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAI
DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFW
PAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQ
RFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPE
TEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKI
FNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEK
CKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEH
KRTCRRKR
Download sequence
Identical sequences A0A2I2YRE7 A0A2J8RIT5 K7DJY6
NP_001189393.1.87134 NP_001189393.1.92137 XP_005252418.1.92137 XP_005252419.1.92137 XP_006717439.1.92137 XP_008951326.1.60992 XP_008951327.1.60992 XP_009456107.1.37143 XP_009456108.1.37143 XP_009456109.1.37143 XP_009456110.1.37143 XP_016818013.1.37143 XP_016871081.1.92137 XP_016871082.1.92137 XP_018890829.1.27298 XP_018890830.1.27298 ENSP00000371020 gi|321117022|ref|NP_001189393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]