SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|321117043|ref|NP_001189395.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|321117043|ref|NP_001189395.1|
Domain Number 1 Region: 215-337
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.93e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 111-208
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000000000994
Family Bromodomain 0.0027
Further Details:      
 
Domain Number 3 Region: 502-545
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000101
Family MYND zinc finger 0.013
Further Details:      
 
Weak hits

Sequence:  gi|321117043|ref|NP_001189395.1|
Domain Number - Region: 408-473
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0302
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|321117043|ref|NP_001189395.1|
Sequence length 547
Comment zinc finger MYND domain-containing protein 11 isoform e [Homo sapiens]
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAI
DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDS
EQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPET
EAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIF
NDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKC
KEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHK
RTCRRKR
Download sequence
Identical sequences A0A2I3H0S0 A0A2J8J3Y3 A0A2J8RIQ2 B7Z2J6
ENSP00000309992 gi|321117043|ref|NP_001189395.1| NP_001189395.1.87134 NP_001189395.1.92137 XP_012355013.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]