SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|321117053|ref|NP_001189396.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|321117053|ref|NP_001189396.1|
Domain Number 1 Region: 216-338
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.75e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 111-209
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-16
Family Bromodomain 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|321117053|ref|NP_001189396.1|
Domain Number - Region: 409-474
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0275
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|321117053|ref|NP_001189396.1|
Sequence length 514
Comment zinc finger MYND domain-containing protein 11 isoform f [Homo sapiens]
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAI
DLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFW
PAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQ
RFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPE
TEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKI
FNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEK
CKEEFVEEIKKLATQHKQLISQTKKKQWVNTSLF
Download sequence
Identical sequences NP_001189396.1.87134 NP_001189396.1.92137 gi|321117053|ref|NP_001189396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]