SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|321117514|ref|NP_001189358.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|321117514|ref|NP_001189358.1|
Domain Number 1 Region: 108-478
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.16e-77
Family Ankyrin repeat 0.000019
Further Details:      
 
Domain Number 2 Region: 585-633
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000589
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|321117514|ref|NP_001189358.1|
Sequence length 635
Comment ankyrin repeat and SOCS box protein 2 isoform 1 [Homo sapiens]
Sequence
MATQISTRGSQCTIGQEEYSLYSSLSEDELVQMAIEQSLADKTRGPTTAEATASACTNRQ
PAHFYPWTRSTAPPESSPARAPMGLFQGVMQKYSSSLFKTSQLAPADPLIKAIKDGDEEA
LKTMIKEGKNLAEPNKEGWLPLHEAAYYGQVGCLKVLQRAYPGTIDQRTLQEETAVYLAT
CRGHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNAEAVKILVQHNADTNHRCNRGWT
ALHESVSRNDLEVMQILVSGGAKVESKNAYGITPLFVAAQSGQLEALRFLAKYGADINTQ
ASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKGNYRIVQMLLPVT
SRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTPLAPERARLYEDRRSSALYFAVV
NNNVYATELLLQHGADPNRDVISPLLVAIRHGCLRTMQLLLDHGANIDAYIATHPTAFPA
TIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVVQF
CEFVSAPEVSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAHLC
RLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
Download sequence
Identical sequences A0A024R6E7
ENSP00000320675 ENSP00000451575 ENSP00000480388 ENSP00000451575 gi|321117514|ref|NP_001189358.1| NP_001189358.1.87134 NP_001189358.1.92137 XP_005267815.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]