SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|321267560|ref|NP_001155907.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|321267560|ref|NP_001155907.2|
Domain Number 1 Region: 62-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-30
Family Ankyrin repeat 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|321267560|ref|NP_001155907.2|
Sequence length 251
Comment ankyrin repeat domain containing protein [Homo sapiens]
Sequence
MDTTLRMVRTACQHRAPQISHKTGCSHISMHSPGGLTTTKMAGPLPRVSDSLFSAMELAK
MSDMTKLHQAVAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIE
YGARPCLVTSVGWTPAHFAAEAGHLNILKTLHALHAAIDAPDFFGDTPKRIAQIYGQKAC
VAFLEKAEPECQDHRCAAQQKGLPLDERDEDWDAKKRELELSLPSLNQNMNKKNKKSRGP
TRPSNTKGRRV
Download sequence
Identical sequences B4E2M5
ENSP00000454770 gi|321267560|ref|NP_001155907.2| NP_001155907.2.87134 NP_001155907.2.92137 ENSP00000454770 ENSP00000454770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]