SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32171201|ref|NP_859077.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32171201|ref|NP_859077.1|
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-23
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32171201|ref|NP_859077.1|
Sequence length 158
Comment ankyrin repeat domain-containing protein 37 [Homo sapiens]
Sequence
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQ
DVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIK
CMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Download sequence
Identical sequences Q7Z713
ENSP00000421529 ENSP00000335147 gi|32171201|ref|NP_859077.1| ENSP00000335147 9606.ENSP00000335147 NP_859077.1.87134 NP_859077.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]