SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32401437|ref|NP_861453.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|32401437|ref|NP_861453.1|
Domain Number - Region: 59-124
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0326
Family Linker histone H1/H5 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32401437|ref|NP_861453.1|
Sequence length 255
Comment testis-specific H1 histone [Homo sapiens]
Sequence
MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRV
SQLVLQAISTHKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYF
RVWKVPKPRRKPGRARQEEGTRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKA
KANARARRTRRARPRAKEPPCARAKEEAGATAADEGRGQAVKEDTTPRSGKDKRRSSKPR
EEKQEPKKPAQRTIQ
Download sequence
Identical sequences A0A140VK96 Q75WM6
NP_861453.1.87134 NP_861453.1.92137 9606.ENSP00000334805 gi|32401437|ref|NP_861453.1| ENSP00000334805 ENSP00000334805 ENSP00000334805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]