SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32490559|ref|NP_054764.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32490559|ref|NP_054764.2|
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-17
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 398-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 139-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 35-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000034
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|32490559|ref|NP_054764.2|
Domain Number - Region: 328-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 356-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32490559|ref|NP_054764.2|
Sequence length 713
Comment low-density lipoprotein receptor-related protein 10 precursor [Homo sapiens]
Sequence
MLLATLLLLLLGGALAHPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWL
ILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAG
ARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFP
GLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALD
LGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNA
TYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGH
FPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGG
GPGARRRQRGRLMRRLVRRLRRWGLLPRTNTPARASEARSQVTPSAAPLEALDGGTGPAR
EGGAVGGQDGEQAPPLPIKAPLPSASTSPAPTTVPEAPGPLPSLPLEPSLLSGVVQALRG
RLLPSLGPPGPTRSPPGPHTAVLALEDEDDVLLVPLAEPGVWVAEAEDEPLLT
Download sequence
Identical sequences Q7Z4F1
ENSP00000352601 9606.ENSP00000352601 gi|32490559|ref|NP_054764.2| ENSP00000352601 ENSP00000352601 NP_054764.2.87134 NP_054764.2.92137 NYSGRC-32490559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]