SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32528293|ref|NP_006366.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32528293|ref|NP_006366.2|
Domain Number 1 Region: 73-179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000448
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32528293|ref|NP_006366.2|
Sequence length 581
Comment ecto-NOX disulfide-thiol exchanger 2 isoform a [Homo sapiens]
Sequence
MTLPMSDPTAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIPPITPMMPGLGIVPPP
IPPDMPVVKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVEVFE
QCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARD
DLYEWECKQRMLAREERHRRRMEEERLRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAV
QTLLTWIERGEVNRRSANNFYSMIQSANSHVRRLVNEKAAHEKDMEEAKEKFKQALSGIL
IQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMS
DDEIEEMTETKETEESALVSQAEALKEENDSLRWQLDAYRNEVELLKQEQGKVHREDDPN
KEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELEKLKDDKLQVEKMLENLKEKESCASRL
CASNQDSEYPLEKTMNSSPIKSEREALLVGIISTFLHVHPFGASIEYICSYLHRLDNKIC
TSDVECLMGRLQHTFKQEMTGVGASLEKRWKFCGFEGLKLT
Download sequence
Identical sequences gi|32528293|ref|NP_006366.2| ENSP00000359973 ENSP00000377890 NP_001268665.1.87134 NP_001268665.1.92137 NP_006366.2.87134 NP_006366.2.92137 XP_011529553.1.92137 ENSP00000359973 ENSP00000377890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]