SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32967311|ref|NP_004422.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967311|ref|NP_004422.2|
Domain Number 1 Region: 605-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-82
Family Protein kinases, catalytic subunit 0.000000000108
Further Details:      
 
Domain Number 2 Region: 28-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-67
Family Ephrin receptor ligand binding domain 0.00000881
Further Details:      
 
Domain Number 3 Region: 328-527
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-30
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 897-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.8e-19
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 
Domain Number 5 Region: 259-330,366-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000129
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32967311|ref|NP_004422.2|
Sequence length 976
Comment ephrin type-A receptor 2 precursor [Homo sapiens]
Sequence
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
Download sequence
Identical sequences A0A024QZA8 P29317
ENSP00000351209 ENSP00000484980 NP_004422.2.87134 NP_004422.2.92137 ENSP00000351209 hsg002000008.1 gi|32967311|ref|NP_004422.2| ENSP00000351209 9606.ENSP00000351209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]