SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32967314|ref|NP_872585.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967314|ref|NP_872585.1|
Domain Number 1 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-73
Family Ephrin receptor ligand binding domain 0.000000941
Further Details:      
 
Domain Number 2 Region: 325-531
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-40
Family Fibronectin type III 0.0000769
Further Details:      
 
Domain Number 3 Region: 253-317,363-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000162
Family Growth factor receptor domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32967314|ref|NP_872585.1|
Sequence length 539
Comment ephrin type-A receptor 3 isoform b precursor [Homo sapiens]
Sequence
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDCMYYFNAV
Download sequence
Identical sequences NP_872585.1.87134 NP_872585.1.92137 ENSP00000399926 gi|32967314|ref|NP_872585.1| ENSP00000399926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]