SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32996709|ref|NP_861974.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32996709|ref|NP_861974.1|
Domain Number 1 Region: 45-133
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 9.42e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32996709|ref|NP_861974.1|
Sequence length 224
Comment transmembrane emp24 domain-containing protein 7 precursor [Homo sapiens]
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS
Download sequence
Identical sequences A0A2I3RGE1 Q9Y3B3
gi|32996709|ref|NP_861974.1| ENSPTRP00000029346 NP_001191238.1.37143 NP_861974.1.87134 NP_861974.1.92137 ENSPTRP00000029346 ENSP00000405926 ENSP00000405926 ENSP00000405926 9606.ENSP00000405926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]