SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331999954|ref|NP_002263.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331999954|ref|NP_002263.3|
Domain Number 1 Region: 368-445
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.28e-22
Family Intermediate filament protein, coiled coil region 0.00051
Further Details:      
 
Domain Number 2 Region: 136-170
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000188
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Domain Number 3 Region: 176-246
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000267
Family Intermediate filament protein, coiled coil region 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|331999954|ref|NP_002263.3|
Domain Number - Region: 341-377
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.00667
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331999954|ref|NP_002263.3|
Sequence length 520
Comment keratin, type II cytoskeletal 4 [Homo sapiens]
Sequence
MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKS
ISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLT
PLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTS
SKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAEND
FVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNR
NLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNR
MIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLR
EYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGLGSGS
GFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR
Download sequence
Identical sequences gi|331999954|ref|NP_002263.3| NP_002263.3.87134 NP_002263.3.92137 ENSP00000448220 ENSP00000448220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]