SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332164762|ref|NP_001193719.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332164762|ref|NP_001193719.1|
Domain Number 1 Region: 307-428
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.68e-35
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 224-320
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-18
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 203-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000929
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332164762|ref|NP_001193719.1|
Sequence length 491
Comment transmembrane protease serine 13 isoform 3 [Homo sapiens]
Sequence
MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQAS
PAGTPPGRASPGRASPAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVY
LVRATPVGAVPIRSSPARSAPATRATRESPGTSLPKFTWREGQKQLPLIGCVLLLIALVV
SLIILFQFWQGHTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYS
GSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLH
RSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQW
VLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRL
SKPLTLSGEGICTPRSPAPQPQHPLQPSHLSASVNSYPGPKASAGQKSKTLKDPYMEHFC
FIIRETEAQGL
Download sequence
Identical sequences ENSP00000436502 gi|332164762|ref|NP_001193719.1| ENSP00000436502 NP_001193719.1.87134 NP_001193719.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]