SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33342268|ref|NP_620129.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33342268|ref|NP_620129.2|
Domain Number 1 Region: 160-266
Classification Level Classification E-value
Superfamily R3H domain 1.86e-19
Family R3H domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33342268|ref|NP_620129.2|
Sequence length 268
Comment R3H domain-containing protein C19orf22 [Homo sapiens]
Sequence
MVALENPECGPEAAEGTPGGRRLLPLPSCLPALASSQVKRLSASRRKQHFINQAVRNSDL
VPKAKGRKSLQRLENTQYLLTLLETDGGLPGLEDGDLAPPASPGIFAEACNNATYVEVWN
DFMNRSGEEQERVLRYLEDEGRSKARRRGPGRGEDRRREDPAYTPRECFQRISRRLRAVL
KRSRIPMETLETWEERLLRFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEG
KRQMKVSNRHLDFLPPGLLLSAYLEQHS
Download sequence
Identical sequences Q96D70
ENSP00000355385 ENSP00000355385 NP_620129.2.87134 NP_620129.2.92137 gi|33342268|ref|NP_620129.2| ENSP00000355385 9606.ENSP00000355385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]