SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334688844|ref|NP_001229305.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334688844|ref|NP_001229305.1|
Domain Number 1 Region: 294-372
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-23
Family Intermediate filament protein, coiled coil region 0.0000343
Further Details:      
 
Domain Number 2 Region: 68-104
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000335
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Weak hits

Sequence:  gi|334688844|ref|NP_001229305.1|
Domain Number - Region: 121-174
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.022
Family Intermediate filament protein, coiled coil region 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334688844|ref|NP_001229305.1|
Sequence length 438
Comment glial fibrillary acidic protein isoform 3 [Homo sapiens]
Sequence
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRGQYSRASWEGHWSPAPSSRACRLLQTGTED
QGKGIQLSLGAFVTLQRS
Download sequence
Identical sequences ENSP00000468500 ENSP00000403962 ENSP00000468500 NP_001229305.1.87134 NP_001229305.1.92137 gi|334688844|ref|NP_001229305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]