SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33504571|ref|NP_878274.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33504571|ref|NP_878274.1|
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily PX domain 5.36e-26
Family PX domain 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|33504571|ref|NP_878274.1|
Domain Number - Region: 192-281
Classification Level Classification E-value
Superfamily TPR-like 0.000759
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33504571|ref|NP_878274.1|
Sequence length 316
Comment sorting nexin-20 isoform 1 [Homo sapiens]
Sequence
MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTREL
QQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDF
AKLQKALLKTFREEIEDVEFPRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREF
LDFLTRPELREAFGCLRAGQYPRALELLLRVLPLQEKLTAHCPAAAVPALCAVLLCHRDL
DRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYALGKDFVTLQERLEESQLRRPT
PRGITLKELTVREYLH
Download sequence
Identical sequences Q7Z614
9606.ENSP00000332062 gi|33504571|ref|NP_878274.1| ENSP00000332062 NP_878274.1.87134 NP_878274.1.92137 ENSP00000332062 ENSP00000332062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]