SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338797770|ref|NP_001229740.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338797770|ref|NP_001229740.1|
Domain Number 1 Region: 14-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.8e-68
Family Ankyrin repeat 0.0000618
Further Details:      
 
Weak hits

Sequence:  gi|338797770|ref|NP_001229740.1|
Domain Number - Region: 668-720
Classification Level Classification E-value
Superfamily Prefoldin 0.0706
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338797770|ref|NP_001229740.1|
Sequence length 727
Comment ankyrin repeat domain-containing protein 6 isoform a [Homo sapiens]
Sequence
MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGF
SQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHV
AARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRDEVAQSKG
SVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSDPTPPADQQPG
HQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRL
QQHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVD
QLVVTAGPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPM
NEAARSDQQAGPCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRD
TSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLR
TRVQKEN
Download sequence
Identical sequences Q9Y2G4
gi|338797766|ref|NP_001229738.1| gi|338797770|ref|NP_001229740.1| ENSP00000358416 ENSP00000345767 ENSP00000430985 ENSP00000345767 ENSP00000430985 NP_001229738.1.87134 NP_001229738.1.92137 NP_001229740.1.87134 NP_001229740.1.92137 XP_005248738.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]