SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338797775|ref|NP_055757.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338797775|ref|NP_055757.3|
Domain Number 1 Region: 14-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.72e-68
Family Ankyrin repeat 0.0000618
Further Details:      
 
Weak hits

Sequence:  gi|338797775|ref|NP_055757.3|
Domain Number - Region: 416-517
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0144
Family Apolipoprotein A-I 0.023
Further Details:      
 
Domain Number - Region: 663-715
Classification Level Classification E-value
Superfamily Prefoldin 0.068
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338797775|ref|NP_055757.3|
Sequence length 722
Comment ankyrin repeat domain-containing protein 6 isoform b [Homo sapiens]
Sequence
MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGF
SQSAKLLIKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHV
AARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRDEVAQSKG
SVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSDPTPPADQQPG
HQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRL
QQHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCVDQLVVT
AGPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPMNEAAR
SDQQAGPCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQAL
ELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLRTRVQK
EN
Download sequence
Identical sequences NP_055757.3.87134 NP_055757.3.92137 ENSP00000396771 9606.ENSP00000396771 ENSP00000396771 gi|338797775|ref|NP_055757.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]