SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338797779|ref|NP_001229743.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338797779|ref|NP_001229743.1|
Domain Number 1 Region: 14-205
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-51
Family Ankyrin repeat 0.00011
Further Details:      
 
Weak hits

Sequence:  gi|338797779|ref|NP_001229743.1|
Domain Number - Region: 357-458
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0119
Family Apolipoprotein A-I 0.023
Further Details:      
 
Domain Number - Region: 604-656
Classification Level Classification E-value
Superfamily Prefoldin 0.0628
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338797779|ref|NP_001229743.1|
Sequence length 663
Comment ankyrin repeat domain-containing protein 6 isoform d [Homo sapiens]
Sequence
MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKAGNTALHLACQNSH
SQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHV
AAALNHKKVAKILLEAGADTTIVNNVLRFSRGRSLRKKRERLKEERRAQSVPRDEVAQSK
GSVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSDPTPPADQQP
GHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLIN
KLENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNR
LQQHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCVDQLVV
TAGPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPMNEAA
RSDQQAGPCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQA
LELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLRTRVQ
KEN
Download sequence
Identical sequences ENSP00000429782 NP_001229743.1.87134 NP_001229743.1.92137 XP_011533902.1.92137 ENSP00000429782 gi|338797779|ref|NP_001229743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]