SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339276005|ref|NP_001229837.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339276005|ref|NP_001229837.1|
Domain Number 1 Region: 37-144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.54e-17
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000102
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339276005|ref|NP_001229837.1|
Sequence length 263
Comment R-spondin-1 isoform 1 [Homo sapiens]
Sequence
MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
Download sequence
Identical sequences Q2MKA7
gi|339276005|ref|NP_001229837.1| gi|84490388|ref|NP_001033722.1| ENSP00000348944 ENSP00000383846 ENSP00000383847 9606.ENSP00000348944 ENSP00000348944 ENSP00000383846 ENSP00000383846 NP_001033722.1.87134 NP_001033722.1.92137 NP_001229837.1.87134 NP_001229837.1.92137 XP_006710646.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]