SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341913654|ref|XP_003403667.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341913654|ref|XP_003403667.1|
Domain Number 1 Region: 178-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-35
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 16-129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.02e-27
Family MAM domain 0.012
Further Details:      
 
Domain Number 3 Region: 489-610
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-18
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 135-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 392-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000657
Family MAM domain 0.018
Further Details:      
 
Domain Number 6 Region: 353-392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341913654|ref|XP_003403667.1|
Sequence length 632
Comment PREDICTED: MAM and LDL-receptor class A domain-containing protein C10orf112 [Homo sapiens]
Sequence
MGLARAVSKLWGVSQNTTDGWYLYADSSNGKFGDTADILTPIISLTGPKCTLVFWTHMNG
ATVGSLQVLIKKDNVTSKLWAQTGQQGAQWKRAEVFLGIRSHTQIVFRAKRGISYIGDVA
VDDISFQDCSPLLSPERKCTDHEFMCANKHCIAKDKLCDFVNDCADNSDETTFICRTSSG
RCDFEFDLCSWKQEKDEDFDWNLKASSIPAAGTEPAADHTLGNSSGHYIFINSLFPQQPM
RAARISSPVISKRSKNCKIIFHYHMYGNGIGALTLMQVSVTNQTKVLLNLTVEQGNFWRR
EELSLFGDEDFQLKFEGRVGKGQRGDIALDDIVLTENCLSLHDSVQEELAVPLPTGFCPL
GYRECHNGKCYRLEQSCNFVDNCGDNTGENKCGSSCTFEKGWCGWQNSQADNFDWVLGVG
SHQSLRPPKDHTLGNENAILLMRRHKYPIRSVNLHTVKHVLKAQTVGNCSVSKLEARLLD
FLSVPNENTFGSSDHMNWHFMYLEATAVGLRGDKAHFRSTMWRESSAACTMSFWYFISAK
ATGSIQILIKTEKGLSKVWQESKQNPGNHWQKADILLGKLRNFEVIFQGIRTRDLGGGAA
IDDIEFKNCTTVETYIQRWECLRLEMHYKNTF
Download sequence
Identical sequences gi|341913654|ref|XP_003403667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]