SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341914329|ref|XP_001717391.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341914329|ref|XP_001717391.3|
Domain Number 1 Region: 224-356
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-22
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 150-229
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000012
Family Ubiquitin-related 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341914329|ref|XP_001717391.3|
Sequence length 401
Comment PREDICTED: ankyrin repeat domain-containing protein 60 [Homo sapiens]
Sequence
MSLYLSINLPVALGSTYVLFHYLRTVSRGRVKLRLCSSRSGKGLRDLGGPPAHRSPWRLG
RQAGRGLALRLEGAVLAGPGRHSGAGGAWARLGASGARAGAQGCGGPRVGSADSRALPAQ
PLACARGRSQRLVCDPKAASALPDLAPDVFVLRVRLEETGEMFRVANCRGDMTVRELKEE
LDLMVGIPFNLQRLQYLDEGVLMDDTTLKFHDVVPGGIISLCIWHHDGWTELVLAAVEGD
PSKLSCLGLTEDSFYRTANSEHFEGEKWKHWTSQRAFVALYVASHRGHFDAVQYLLEHGA
SCLSRSPLGRTPLHVAAAMGRSDCIILLLQHGASIHDRDAKGETPISIAHCLNHTLSERQ
MVLLHRIAKSGIRDLNDLVMKNALQRVKSGFRSEKMTMTPH
Download sequence
Identical sequences gi|341914329|ref|XP_001717391.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]