SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341914599|ref|XP_001714535.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341914599|ref|XP_001714535.3|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-75
Family Ankyrin repeat 0.0000158
Further Details:      
 
Domain Number 2 Region: 352-450
Classification Level Classification E-value
Superfamily DEATH domain 5.38e-16
Family DEATH domain, DD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341914599|ref|XP_001714535.3|
Sequence length 462
Comment PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat and death domain-containing protein 1B [Homo sapiens]
Sequence
MNRTALHFAVGRNHLSAVDFLLKHKARVDVADKHGLTVIHLAAWSGSLEVMLMLVKAGAD
QRAKNQDGMSALHFATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIE
KLTFLNLHTSEKDKGGNTALHLAAKHGHSPAVQVLLAQWQDINEMNENGETPFFLSVEGG
HEECSKVLLTAGSDTNIPNKLNISSLQIATRNGHASLVNFLLSENVDLHQKVEPKESPLH
LVVINNHITVVNSLLSAQHDIDILNQKQQTPLHVAADRGNVELVETLLKAGCDLKAVDKQ
GKTALAVASRSNHSLVVGMLIKAERYYAWREEHHESIRDPSTGFTLTFKQDHSLETRHIR
TLLWDLAYHQLKANEWQRLARSWNFTDDQIRAIEEQWSGNESFREHGHRALLIXLHGTLM
TQGDPAKQLYEELVHAGFPKLAEKTRHFKSKTDSNSKKCVVS
Download sequence
Identical sequences gi|341914599|ref|XP_001714535.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]