SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341915506|ref|XP_295865.9| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341915506|ref|XP_295865.9|
Domain Number 1 Region: 178-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-34
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 671-835
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-31
Family MAM domain 0.00084
Further Details:      
 
Domain Number 3 Region: 16-129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-26
Family MAM domain 0.012
Further Details:      
 
Domain Number 4 Region: 135-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 847-884
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 629-666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 965-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000003
Family EGF-type module 0.036
Further Details:      
 
Domain Number 8 Region: 888-926
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 9 Region: 392-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000119
Family MAM domain 0.018
Further Details:      
 
Domain Number 10 Region: 353-392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 11 Region: 487-559
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000237
Family MAM domain 0.0075
Further Details:      
 
Domain Number 12 Region: 930-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|341915506|ref|XP_295865.9|
Sequence length 1101
Comment PREDICTED: MAM and LDL-receptor class A domain-containing protein C10orf112 [Homo sapiens]
Sequence
MGLARAVSKLWGVSQNTTDGWYLYADSSNGKFGDTADILTPIISLTGPKCTLVFWTHMNG
ATVGSLQVLIKKDNVTSKLWAQTGQQGAQWKRAEVFLGIRSHTQIVFRAKRGISYIGDVA
VDDISFQDCSPLLSPERKCTDHEFMCANKHCIAKDKLCDFVNDCADNSDETTFICRTSSG
RCDFEFDLCSWKQEKDEDFDWNLKASSIPAAGTEPAADHTLGNSSGHYIFIKSLFPQQPM
RAARISSPVISKRSKNCKIIFHYHMYGNGIGALTLMQVSVTNQTKVLLNLTVEQGNFWRR
EELSLFGDEDFQLKFEGRVGKGQRGDIALDDIVLTENCLSLHDSVQEELAVPLPTGFCPL
GYRECHNGKCYRLEQSCNFVDNCGDNTDENECGSSCTFEKGWCGWQNSQADNFDWVLGVG
SHQSLRPPKDHTLGNENAILLMRRHKYPIRSVNLHTVKHVLKAQTVGNCSVSKLEARLLD
FLSVPNENTFGSSDHTNWHFMYLEATAVGLRGDKAHFRSTMWRESSAACTMSFWYFVSAK
ATGSIQILIKRGRRRRRAPNPVLSGSPTIPRQGSQQLGGWRGGSARHRARAFPEPECPRG
RSALLKGPPQEKPNRRSALLSVGEISELCPEITDFLCRDKKCIASHLLCDYKPDCSDRSD
EAHCAHYTSTTGSCNFETSSGNWTTACSLTQDSEDDLDWAIGSRIPAKALIPDSDHTPGS
GQHFLYVNSSGSKEGSVARITTSKSFPASLGMCTVRFWFYMIDPRSMGILKVYTIEESGL
NILVWSVIGNKRTGWTYGSVPLSSNSPFKVAFEADLDGNEDIFIALDDISFTPECVTGGP
VPVQPSPCEADQFSCIYTLQCVPLSGKCDGHEDCIDGSDEMDCPLSPTPPLCSNMEFPCS
TDECIPSLLLCDGVPDCHFNEDELICSNKSCSNGALVCASSNSCIPAHQRCDGFADCMDF
QLDESSCSECPLNYCRNGGTCVVEKNGPMCRCRQGWKGNRCHIKFNPPATDFTYAQNNTW
TLLGIGLAFLMTHITVAVLCFLANRKVPIRKTEGSGNCAFVNPVYGNWSNPEKTESSVYS
FSNPLYGTTSGSLETLSHHLK
Download sequence
Identical sequences gi|341915506|ref|XP_295865.9|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]