SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34304383|ref|NP_775748.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34304383|ref|NP_775748.2|
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-31
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 390-451
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000539
Family SAM (sterile alpha motif) domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|34304383|ref|NP_775748.2|
Sequence length 461
Comment Usher syndrome type-1G protein [Homo sapiens]
Sequence
MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDK
CDIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMERRYRRELAERSDTLSFSS
LTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERRKQGGEGTFKVSEDGRKS
ARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSVSRATLAAEPAHSEVSTD
SGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPRGRLQSSPSLDDDSLGSA
NSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFAALLRQEKIDLEALML
CSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL
Download sequence
Identical sequences Q495M9
GO.99370 ENSP00000320076 ENSP00000480279 NP_775748.2.87134 NP_775748.2.92137 ENSP00000320076 9606.ENSP00000320076 gi|34304383|ref|NP_775748.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]