SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34419635|ref|NP_002146.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34419635|ref|NP_002146.2|
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.58e-72
Family Actin/HSP70 0.0000000515
Further Details:      
 
Domain Number 2 Region: 193-384
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.48e-71
Family Actin/HSP70 0.0000000177
Further Details:      
 
Domain Number 3 Region: 388-545
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 8.5e-64
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000115
Further Details:      
 
Domain Number 4 Region: 540-621
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 1.57e-25
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34419635|ref|NP_002146.2|
Sequence length 643
Comment heat shock 70 kDa protein 6 [Homo sapiens]
Sequence
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Download sequence
Identical sequences P17066
gi|34419635|ref|NP_002146.2| ENSP00000310219 ENSP00000310219 NP_002146.2.87134 NP_002146.2.92137 9606.ENSP00000310219 ENSP00000310219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]