SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34452688|ref|NP_899180.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34452688|ref|NP_899180.1|
Domain Number 1 Region: 290-419
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-43
Family Regulator of G-protein signaling, RGS 0.00000293
Further Details:      
 
Domain Number 2 Region: 13-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-29
Family DEP domain 0.0039
Further Details:      
 
Domain Number 3 Region: 216-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.09e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|34452688|ref|NP_899180.1|
Sequence length 467
Comment regulator of G-protein signaling 11 isoform 1 [Homo sapiens]
Sequence
MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQW
LAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAE
LDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRL
VIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRT
RVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERW
GFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYEQFLA
PGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA
Download sequence
Identical sequences O94810 Q4TT70
NP_899180.1.87134 NP_899180.1.92137 ENSP00000380876 ENSP00000380876 ENSP00000168869 gi|34452688|ref|NP_899180.1| 9606.ENSP00000380876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]