SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34577122|ref|NP_003989.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34577122|ref|NP_003989.2|
Domain Number 1 Region: 42-253
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-83
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000171
Further Details:      
 
Domain Number 2 Region: 543-761
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.7e-59
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 249-381
Classification Level Classification E-value
Superfamily E set domains 3.5e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 4 Region: 809-890
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|34577122|ref|NP_003989.2|
Domain Number - Region: 875-923
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0102
Family DNA polymerase beta, N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34577122|ref|NP_003989.2|
Sequence length 969
Comment nuclear factor NF-kappa-B p105 subunit isoform 1 [Homo sapiens]
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ
AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGD
FSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV
QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITF
HPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNG
EVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQ
DENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVE
DLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAM
MSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG
TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMA
TSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL
GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTS
QAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYG
QEGPLEGKI
Download sequence
Identical sequences G3RSI9 H2QPY8
9598.ENSPTRP00000028033 9606.ENSP00000226574 NP_003989.2.87134 NP_003989.2.92137 XP_001168718.1.37143 XP_018881357.1.27298 ENSPTRP00000028033 ENSP00000226574 ENSPTRP00000028033 ENSP00000226574 ENSP00000226574 gi|34577122|ref|NP_003989.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]