SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|34878749|ref|NP_904319.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34878749|ref|NP_904319.1|
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.49e-18
Family F-box domain 0.0028
Further Details:      
 
Domain Number 2 Region: 68-124
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000298
Family F-box associated region, FBA 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34878749|ref|NP_904319.1|
Sequence length 224
Comment F-box only protein 44 isoform 2 [Homo sapiens]
Sequence
MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPND
QVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLPARRPL
HLVSARRRGHSLLGRLVRPEGHQQQHHHRAPAALTPPEPPSAEP
Download sequence
Identical sequences A0A024R4J6
ENSP00000251546 ENSP00000365951 ENSP00000365953 ENSP00000251546 ENSP00000365951 ENSP00000365953 NP_001291719.1.87134 NP_001291719.1.92137 NP_904319.1.87134 NP_904319.1.92137 NP_904320.1.87134 NP_904320.1.92137 XP_016858333.1.92137 gi|34878749|ref|NP_904319.1| gi|34878753|ref|NP_904320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]