SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37574731|ref|NP_932074.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37574731|ref|NP_932074.1|
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-27
Family Canonical RBD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37574731|ref|NP_932074.1|
Sequence length 295
Comment protein boule-like isoform 1 [Homo sapiens]
Sequence
METESGPQTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESD
LRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPA
IRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSP
VMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGG
CVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Download sequence
Identical sequences gi|37574731|ref|NP_932074.1| ENSP00000314792 ENSP00000314792 NP_932074.1.87134 NP_932074.1.92137 9606.ENSP00000314792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]