SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37622903|ref|NP_932174.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37622903|ref|NP_932174.1|
Domain Number 1 Region: 124-198
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 3.01e-29
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37622903|ref|NP_932174.1|
Sequence length 200
Comment TSC22 domain family protein 3 isoform 1 [Homo sapiens]
Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENL
NTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI
EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences K7ESR1
ENSP00000314655 ENSP00000361458 ENSP00000361459 ENSP00000427427 ENSPPYP00000023578 ENSPPYP00000023074 ENSP00000314655 ENSP00000314655 ENSP00000361458 ENSP00000361459 ENSP00000427427 NP_001305397.1.87134 NP_001305397.1.92137 NP_001305399.1.87134 NP_001305399.1.92137 NP_932174.1.87134 NP_932174.1.92137 XP_005262156.1.92137 XP_005262157.1.92137 XP_005262159.1.92137 XP_005262160.1.92137 XP_009233409.1.23681 XP_009233410.1.23681 XP_011529186.1.92137 XP_016884824.1.92137 9606.ENSP00000361458 NYSGRC-37622903 gi|37622903|ref|NP_932174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]