SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38257146|ref|NP_940683.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38257146|ref|NP_940683.1|
Domain Number 1 Region: 13-131
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-30
Family Ankyrin repeat 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38257146|ref|NP_940683.1|
Sequence length 228
Comment ankyrin repeat domain-containing protein 46 [Homo sapiens]
Sequence
MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI
CQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV
NKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR
TTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYVSGVLPFVENQPELVH
Download sequence
Identical sequences A0A024R9E1 A0A0D9RI30 A0A0P6JD18 A0A1D5QKQ1 A0A1S3EU92 A0A1U7SCC0 A0A1U7TL87 A0A286X9V7 A0A2I2YX03 A0A2I3HHV1 A0A2K5EHD5 A0A2K5MFL3 A0A2K5QI78 A0A2K5ZFJ6 A0A2K6BYS0 A0A2K6MXU0 A0A2K6RFM0 A0A2K6T706 F2Z556 F7ICK9 G1L0L3 G7PCF4 H0X6G1 H2PQX5 H2QWI5 I3N9Z9 K9IWV4 L5KB99 L8J1N4 L9JA65 M3WSX0 M3YUS9 Q3SX00 U6CQ14 W5NRZ3
ENSNLEP00000003743 ENSSSCP00000006476 ENSOGAP00000010942 ENSCJAP00000029134 ENSPPYP00000021074 ENSP00000335287 ENSP00000428388 ENSP00000430056 ENSMMUP00000013025 ENSPPYP00000021074 ENSBTAP00000001658 ENSAMEP00000000415 ENSSSCP00000006476 ENSPTRP00000035010 ENSMPUP00000015089 ENSP00000335287 ENSP00000428388 ENSP00000430056 ENSCPOP00000008960 ENSAMEP00000000415 ENSOARP00000000933 ENSOGAP00000010942 ENSFCAP00000017456 10141.ENSCPOP00000008960 9544.ENSMMUP00000013025 9600.ENSPPYP00000021074 9606.ENSP00000335287 9823.ENSSSCP00000006476 9913.ENSBTAP00000001658 9986.ENSOCUP00000008422 ENSOCUP00000008422 ENSBTAP00000001658 ENSMPUP00000015089 ENSSTOP00000021196 ENSPTRP00000035010 ENSMMUP00000013025 ENSSTOP00000021196 ENSNLEP00000003743 NP_001029791.1.59421 NP_001029791.1.76553 NP_001230285.1.46622 NP_001253427.1.72884 NP_001257306.1.87134 NP_001257306.1.92137 NP_001257307.1.87134 NP_001257307.1.92137 NP_001270671.1.63531 NP_940683.1.87134 NP_940683.1.92137 XP_001152837.1.37143 XP_001492540.1.31192 XP_002710761.1.1745 XP_002914027.1.58354 XP_003256111.1.23891 XP_003256112.1.23891 XP_003256113.1.23891 XP_003479910.1.53824 XP_003782491.1.62490 XP_003821757.1.60992 XP_003943072.1.74449 XP_003951362.1.37143 XP_004011859.1.66739 XP_004047423.1.27298 XP_004047424.1.27298 XP_004047426.1.27298 XP_004402407.1.74151 XP_004768950.1.14098 XP_004850223.1.39548 XP_004850224.1.39548 XP_005316353.1.77405 XP_005563864.1.63531 XP_005563865.1.63531 XP_005563866.1.63531 XP_005563867.1.63531 XP_005613288.1.31192 XP_005613289.1.31192 XP_005613290.1.31192 XP_005613291.1.31192 XP_005662999.1.46622 XP_005887070.1.15283 XP_005976740.1.78601 XP_006029333.1.24877 XP_006029335.1.24877 XP_006055294.1.26621 XP_006101937.1.53796 XP_006159763.1.99106 XP_006716572.1.92137 XP_006739864.1.47382 XP_006916709.1.64745 XP_007073369.1.5354 XP_007104909.1.24612 XP_007104910.1.24612 XP_007104911.1.24612 XP_007104912.1.24612 XP_007104913.1.24612 XP_007173472.1.59432 XP_007173473.1.59432 XP_007173474.1.59432 XP_007465799.1.90284 XP_007999414.1.81039 XP_007999415.1.81039 XP_008057168.1.4292 XP_008057169.1.4292 XP_008254017.1.1745 XP_008530029.1.77740 XP_008530030.1.77740 XP_008530031.1.77740 XP_008530032.1.77740 XP_008530033.1.77740 XP_008575917.1.73410 XP_008687430.1.72690 XP_008973430.1.60992 XP_008981651.1.60252 XP_008981652.1.60252 XP_008981653.1.60252 XP_009242263.1.23681 XP_009454015.1.37143 XP_009454016.1.37143 XP_010329166.1.74449 XP_010329167.1.74449 XP_010329168.1.74449 XP_010329169.1.74449 XP_010329170.1.74449 XP_010372472.1.97406 XP_010617847.1.5607 XP_010617848.1.5607 XP_010861818.1.44457 XP_011289717.1.62641 XP_011374485.1.92234 XP_011374486.1.92234 XP_011729988.1.29376 XP_011729990.1.29376 XP_011729991.1.29376 XP_011729992.1.29376 XP_011822113.1.47321 XP_011822114.1.47321 XP_011917060.1.92194 XP_011917061.1.92194 XP_012039443.1.66739 XP_012311263.1.9421 XP_012311264.1.9421 XP_012867981.1.60039 XP_012867982.1.60039 XP_013212938.1.77405 XP_013212943.1.77405 XP_013368284.1.28644 XP_013368285.1.28644 XP_013368286.1.28644 XP_013852025.2.46622 XP_014322754.1.53796 XP_014322755.1.53796 XP_014378044.1.24877 XP_014467091.2.47583 XP_014722852.1.49734 XP_014722853.1.49734 XP_014722854.1.49734 XP_014722855.1.49734 XP_014933506.1.86478 XP_015001223.1.72884 XP_015001224.1.72884 XP_015001225.1.72884 XP_015001226.1.72884 XP_015001227.1.72884 XP_015310291.1.63531 XP_015310292.1.63531 XP_015341827.1.40921 XP_015341828.1.40921 XP_015985263.1.101085 XP_016053982.1.3490 XP_016868595.1.92137 XP_017375176.1.71028 XP_017375178.1.71028 XP_017375179.1.71028 XP_017714960.1.44346 XP_017821147.1.60252 XP_017821148.1.60252 XP_017913795.1.57651 XP_017913796.1.57651 XP_018888268.1.27298 XP_019323525.1.44245 XP_019351295.1.47583 XP_019351296.1.47583 XP_019498111.1.44202 XP_019498112.1.44202 XP_019498113.1.44202 XP_019498114.1.44202 XP_019498115.1.44202 XP_019571936.1.88060 XP_019829415.1.53367 XP_020755672.1.74333 XP_020944189.1.46622 XP_021543943.1.83697 ENSCPOP00000008960 gi|38257146|ref|NP_940683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]