SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38327522|ref|NP_055206.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38327522|ref|NP_055206.2|
Domain Number 1 Region: 124-306
Classification Level Classification E-value
Superfamily Ankyrin repeat 9e-53
Family Ankyrin repeat 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38327522|ref|NP_055206.2|
Sequence length 319
Comment ankyrin repeat domain-containing protein 1 [Homo sapiens]
Sequence
MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQW
KSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVD
VPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIE
FRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIA
CEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTK
AIFDSLRENSYKTSRIATF
Download sequence
Identical sequences Q15327
ENSP00000360762 9606.ENSP00000360762 NP_055206.2.87134 NP_055206.2.92137 gi|38327522|ref|NP_055206.2| GO.41917 HR6157 ENSP00000360762 ENSP00000360762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]