SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38327632|ref|NP_001945.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38327632|ref|NP_001945.3|
Domain Number 1 Region: 566-867
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-72
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 29-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.22e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38327632|ref|NP_001945.3|
Sequence length 876
Comment epithelial discoidin domain-containing receptor 1 isoform 1 precursor [Homo sapiens]
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTL
QGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVS
LDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPL
CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYL
ATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILM
GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACP
QGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Download sequence
Identical sequences A0A024RCQ1 Q1XI08
gi|38327632|ref|NP_001945.3| NP_001284581.1.87134 NP_001284581.1.92137 NP_001284582.1.87134 NP_001284582.1.92137 NP_001945.3.87134 NP_001945.3.92137 XP_003807389.1.60992 XP_003807391.1.60992 XP_009449107.1.37143 XP_009449109.1.37143 XP_016810136.1.37143 ENSP00000259875 ENSP00000365751 ENSP00000365753 ENSP00000365754 ENSP00000383261 ENSP00000383262 ENSP00000383334 ENSP00000383336 ENSP00000383337 ENSP00000400393 ENSP00000401208 ENSP00000405540 ENSP00000406091 ENSP00000407699 ENSP00000415730 ENSP00000416145 ENSP00000416183 ENSP00000259875 ENSP00000365751 ENSP00000365753 ENSP00000365754 ENSP00000383261 ENSP00000383262 ENSP00000383334 ENSP00000383336 ENSP00000383337 ENSP00000400393 ENSP00000401208 ENSP00000405540 ENSP00000406091 ENSP00000407699 ENSP00000415730 ENSP00000416145 ENSP00000416183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]