SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38348298|ref|NP_940895.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38348298|ref|NP_940895.1|
Domain Number 1 Region: 38-172
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-22
Family Ankyrin repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 166-243
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000000000000804
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38348298|ref|NP_940895.1|
Sequence length 266
Comment ankyrin repeat domain-containing protein 45 [Homo sapiens]
Sequence
MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPEN
PHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAW
GRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSL
AVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKM
TTPCQVKSAKSVTSHDQKRSQDDTSN
Download sequence
Identical sequences 9606.ENSP00000331268 NP_940895.1.87134 NP_940895.1.92137 XP_011507768.1.92137 XP_011507769.1.92137 XP_011507770.1.92137 XP_011507772.1.92137 ENSP00000331268 gi|38348298|ref|NP_940895.1| ENSP00000331268 ENSP00000331268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]