SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38373690|ref|NP_057213.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38373690|ref|NP_057213.2|
Domain Number 1 Region: 294-365
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-17
Family PCI domain (PINT motif) 0.0000322
Further Details:      
 
Weak hits

Sequence:  gi|38373690|ref|NP_057213.2|
Domain Number - Region: 131-214
Classification Level Classification E-value
Superfamily TPR-like 0.0398
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38373690|ref|NP_057213.2|
Sequence length 406
Comment COP9 signalosome complex subunit 4 [Homo sapiens]
Sequence
MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLV
ISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDW
RNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTN
EQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQ
QRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSIL
DRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVH
FETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
Download sequence
Identical sequences A0A091DZ63 A0A0D9QWN3 A0A0S2Z5H7 A0A1D5QG35 A0A1S2ZFE6 A0A1S3FIH0 A0A1U7T7M8 A0A2K5DS63 A0A2K5JAP9 A0A2K5RGE6 A0A2K5Z1U9 A0A2K6C281 A0A2K6LKI8 A0A2K6PW52 A7Y521 E2RT55 G1LEI1 G1SJN4 G8F410 H2PDS7 H2QPT3 K9IJE7 L5KYF5 Q4R5E6 Q9BT78 U3FN66
ENSMMUP00000029369 ENSSSCP00000009855 HR3105 ENSMMUP00000029369 ENSPPYP00000016631 ENSSSCP00000009855 gi|38373690|ref|NP_057213.2| ENSAMEP00000005317 ENSCAFP00000013334 ENSP00000264389 NP_001098750.1.72884 NP_001098774.1.46622 NP_001270140.1.63531 NP_057213.2.87134 NP_057213.2.92137 XP_001494383.1.31192 XP_002717111.1.1745 XP_002745694.2.60252 XP_002912512.1.58354 XP_003640149.1.84170 XP_003832298.1.60992 XP_004282211.1.21590 XP_004391624.1.74151 XP_004472726.1.11602 XP_004681211.1.23501 XP_005401444.1.28644 XP_006741948.1.47382 XP_006907651.1.64745 XP_007168003.1.59432 XP_007447596.1.90284 XP_007518546.1.11023 XP_007945000.1.48129 XP_007997285.1.81039 XP_008053795.1.4292 XP_008141821.1.99482 XP_008691523.1.72690 XP_010357250.1.97406 XP_010615554.1.5607 XP_011354645.1.92234 XP_011354646.1.92234 XP_011765805.1.29376 XP_011797161.1.43180 XP_011840817.1.47321 XP_012302454.1.9421 XP_012875702.1.60039 XP_014720682.1.49734 XP_016011694.1.101085 XP_016068579.1.3490 XP_017385723.1.71028 XP_017710247.1.44346 XP_019507746.1.44202 XP_019586885.1.88060 XP_019788406.1.83887 XP_020022758.1.5219 XP_021558130.1.83697 ENSDNOP00000014589 ENSPTRP00000027879 ENSOCUP00000002957 ENSOCUP00000002957 ENSCAFP00000013334 ENSPPYP00000016631 9544.ENSMMUP00000029369 9598.ENSPTRP00000027879 9600.ENSPPYP00000016631 9606.ENSP00000264389 9615.ENSCAFP00000013334 9823.ENSSSCP00000009855 9986.ENSOCUP00000002957 ENSPTRP00000027879 ENSP00000264389 ENSAMEP00000005317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]