SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38488720|ref|NP_073557.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38488720|ref|NP_073557.3|
Domain Number 1 Region: 503-581
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.6e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000106
Further Details:      
 
Domain Number 2 Region: 295-334
Classification Level Classification E-value
Superfamily WW domain 0.00000601
Family WW domain 0.0053
Further Details:      
 
Domain Number 3 Region: 617-686
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000529
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38488720|ref|NP_073557.3|
Sequence length 773
Comment microprocessor complex subunit DGCR8 isoform 1 [Homo sapiens]
Sequence
METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSE
LPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKI
SVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD
KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYE
DDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPT
EPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD
NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESER
PILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSE
PFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNH
ISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKH
TVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQ
YAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCTVDV
Download sequence
Identical sequences H2QL93 Q8WYQ5
ENSP00000263209 ENSP00000263209 ENSPTRP00000024242 gi|38488720|ref|NP_073557.3| ENSP00000263209 NP_073557.3.87134 NP_073557.3.92137 XP_003814114.1.60992 ENSPTRP00000024242 9598.ENSPTRP00000024242 9606.ENSP00000263209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]