SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38570081|ref|NP_941989.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38570081|ref|NP_941989.1|
Domain Number 1 Region: 107-198,395-479
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.14e-45
Family Canonical RBD 0.00000727
Further Details:      
 
Domain Number 2 Region: 7-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-20
Family Canonical RBD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38570081|ref|NP_941989.1|
Sequence length 483
Comment CUGBP Elav-like family member 1 isoform 2 [Homo sapiens]
Sequence
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKG
CCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSP
MVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNL
NTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSS
SSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAY
SGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP
FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDS
KPY
Download sequence
Identical sequences A0A2J8LGU7 A0A2J8WES6 A0A2K5IPG8 A0A2K5WAQ2 A0A2K5ZZR7 A0A2K6B103 F7I5A7 G1RX58
ENSP00000354639 ENSP00000378706 gi|38570081|ref|NP_941989.1| NP_941989.1.87134 NP_941989.1.92137 XP_003279030.1.23891 XP_006865159.1.41390 XP_008966337.1.60992 XP_008966338.1.60992 XP_011518161.1.92137 XP_011722738.1.29376 XP_011818760.1.43180 XP_011856833.1.47321 XP_012369245.1.9945 XP_016775290.1.37143 XP_016872622.1.92137 XP_016872623.1.92137 ENSMMUP00000015302 ENSP00000354639 ENSP00000378706 ENSCJAP00000043873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]