SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38683799|ref|NP_149112.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38683799|ref|NP_149112.1|
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-18
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38683799|ref|NP_149112.1|
Sequence length 590
Comment ankyrin repeat domain-containing protein 13A [Homo sapiens]
Sequence
MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVL
LRHKADVTKENRQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAP
DFYVQMKWEFTSWVPLVSRICPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKG
EDNWAELMEVNHDDKVVTTERFDLSQEMERLTLDLMKPKSREVERRLTSPVINTSLDTKN
IAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKIRTEHLTEEEKKRYKADRNPL
ESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRPKELTIRTQKF
KAMLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN
ARITFGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHL
QDEDYEIMQFAIQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLC
PSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK
Download sequence
Identical sequences H2NIL7 H2Q6V1 Q3ZTS7 Q8IZ07
ENSP00000261739 ENSP00000261739 ENSP00000261739 NP_149112.1.87134 NP_149112.1.92137 XP_002823775.1.23681 XP_509359.3.37143 ENSPPYP00000005639 ENSPTRP00000009226 ENSPTRP00000009226 ENSPPYP00000005639 gi|38683799|ref|NP_149112.1| 9598.ENSPTRP00000009226 9600.ENSPPYP00000005639 9606.ENSP00000261739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]