SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|39812133|ref|NP_065082.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39812133|ref|NP_065082.2|
Domain Number 1 Region: 152-320
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.99e-50
Family Ankyrin repeat 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|39812133|ref|NP_065082.2|
Sequence length 360
Comment ankyrin repeat domain-containing protein 2 isoform a [Homo sapiens]
Sequence
MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRG
DARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRK
KRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQF
RRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADT
NVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLL
LHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
Download sequence
Identical sequences Q9GZV1
ENSP00000306163 9606.ENSP00000306163 gi|39812133|ref|NP_065082.2| NP_065082.2.87134 NP_065082.2.92137 ENSP00000359689 ENSP00000306163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]