SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40217843|ref|NP_000086.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40217843|ref|NP_000086.2|
Domain Number 1 Region: 529-744
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-104
Family Thrombospondin C-terminal domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 406-527
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.35e-35
Family TSP type-3 repeat 0.00000307
Further Details:      
 
Domain Number 3 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.62e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00012
Further Details:      
 
Domain Number 4 Region: 337-408
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000248
Family TSP type-3 repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 267-349
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000222
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 6 Region: 173-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000519
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 91-230
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000847
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  gi|40217843|ref|NP_000086.2|
Domain Number - Region: 228-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family EGF-like domain of nidogen-1 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40217843|ref|NP_000086.2|
Sequence length 757
Comment cartilage oligomeric matrix protein precursor [Homo sapiens]
Sequence
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
Download sequence
Identical sequences P49747
9606.ENSP00000222271 ENSP00000222271 ENSP00000403792 gi|40217843|ref|NP_000086.2| ENSP00000222271 NP_000086.2.87134 NP_000086.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]