SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40255043|ref|NP_078782.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40255043|ref|NP_078782.3|
Domain Number 1 Region: 29-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.98e-99
Family Glycosyl hydrolases family 35 catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 474-633
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-30
Family Beta-galactosidase LacA, domains 4 and 5 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40255043|ref|NP_078782.3|
Sequence length 654
Comment beta-galactosidase-1-like protein precursor [Homo sapiens]
Sequence
MAPKKLSCLRSLLLPLSLTLLLPQADTRSFVVDRGHDRFLLDGAPFRYVSGSLHYFRVPR
VLWADRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRP
GPYICAEWEMGGLPSWLLRKPEIHLRTSDPDFLAAVDSWFKVLLPKIYPWLYHNGGNIIS
IQVENEYGSYRACDFSYMRHLAGLFRALLGEKILLFTTDGPEGLKCGSLRGLYTTVDFGP
ADNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLKLGASVN
MYMFHGGTNFGYWNGADKKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQEVPL
GPLPPPSPKMMLGPVTLHLVGHLLAFLDLLCPRGPIHSILPMTFEAVKQDHGFMLYRTYM
THTIFEPTPFWVPNNGVHDRAYVMVDGVFQGVVERNMRDKLFLTGKLGSKLDILVENMGR
LSFGSNSSDFKGLLKPPILGQTILTQWMMFPLKIDNLVKWWFPLQLPKWPYPQAPSGPTF
YSKTFPILGSVGDTFLYLPGWTKGQVWINGFNLGRYWTKQGPQQTLYVPRFLLFPRGALN
KITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
Download sequence
Identical sequences A0A140VJK0 Q6UWU2
ENSP00000295759 ENSP00000375939 ENSP00000295759 ENSP00000375939 9606.ENSP00000295759 gi|40255043|ref|NP_078782.3| NP_001273352.1.87134 NP_001273352.1.92137 NP_078782.3.87134 NP_078782.3.92137 ENSP00000295759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]