SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40316933|ref|NP_954642.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40316933|ref|NP_954642.1|
Domain Number 1 Region: 64-99
Classification Level Classification E-value
Superfamily GLA-domain 0.000000000000824
Family GLA-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40316933|ref|NP_954642.1|
Sequence length 100
Comment osteocalcin preproprotein [Homo sapiens]
Sequence
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Download sequence
Identical sequences P02818 P84349
ENSP00000357255 gi|40316933|ref|NP_954642.1| ENSP00000357255 9606.ENSP00000357255 NP_954642.1.87134 NP_954642.1.92137 XP_004027004.1.27298 ENSGGOP00000020872 ENSP00000357255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]