SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40354195|ref|NP_954657.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40354195|ref|NP_954657.1|
Domain Number 1 Region: 308-385
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.27e-22
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 78-113
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000785
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|40354195|ref|NP_954657.1|
Domain Number - Region: 258-332
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40354195|ref|NP_954657.1|
Sequence length 430
Comment keratin, type I cytoskeletal 18 [Homo sapiens]
Sequence
MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS
GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG
PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN
DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP
KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA
QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
ETNDTKVLRH
Download sequence
Identical sequences A0A024RAY2 G3R3T2 H2Q609 P05783
ENSP00000373487 ENSP00000373489 ENSPTRP00000008508 ENSP00000373487 ENSPTRP00000008508 NP_000215.1.87134 NP_000215.1.92137 NP_954657.1.87134 NP_954657.1.92137 XP_003831107.1.60992 XP_004053249.1.27298 XP_008954686.1.60992 XP_509083.2.37143 9598.ENSPTRP00000008508 9606.ENSP00000373487 ENSP00000373487 ENSP00000373489 HR4755 gi|40354195|ref|NP_954657.1| gi|4557888|ref|NP_000215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]