SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40807480|ref|NP_955453.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40807480|ref|NP_955453.1|
Domain Number 1 Region: 275-383
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 387-427
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000327
Family SOCS box-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|40807480|ref|NP_955453.1|
Sequence length 440
Comment suppressor of cytokine signaling 4 [Homo sapiens]
Sequence
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
Download sequence
Identical sequences Q5H9R6 Q8WXH5
NP_543143.1.87134 NP_543143.1.92137 NP_955453.1.87134 NP_955453.1.92137 XP_011534727.1.92137 XP_011534728.1.92137 gi|18254466|ref|NP_543143.1| gi|40807480|ref|NP_955453.1| 9606.ENSP00000341327 ENSP00000341327 ENSP00000378855 ENSP00000452522 ENSP00000341327 ENSP00000378855 ENSP00000452522 ENSP00000341327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]