SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41281709|ref|NP_640332.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41281709|ref|NP_640332.1|
Domain Number 1 Region: 49-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-39
Family Ankyrin repeat 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41281709|ref|NP_640332.1|
Sequence length 313
Comment NF-kappa-B inhibitor delta [Homo sapiens]
Sequence
MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARG
LRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRS
VLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLST
QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNM
KAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQL
LKRSRVAPPGLSS
Download sequence
Identical sequences Q8NI38
9606.ENSP00000380109 ENSP00000380109 ENSP00000475712 NP_640332.1.87134 NP_640332.1.92137 XP_016882880.1.92137 XP_016882881.1.92137 XP_016882882.1.92137 ENSP00000380109 ENSP00000475712 gi|41281709|ref|NP_640332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]